PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_017687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MYB_related
Protein Properties Length: 752aa    MW: 83956.3 Da    PI: 5.1886
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_017687genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.3e-095092347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e++  a +q G++ +++I ++++  +   q++++++ +
      DCAR_017687 50 AWTRQEEERFFTALRQVGKN-FEKITHRVQ-SKNKDQVRHYYYRL 92
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-104397IPR009057Homeodomain-like
PROSITE profilePS5129313.4924697IPR017884SANT domain
SMARTSM007175.1E-74795IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-54895IPR009057Homeodomain-like
CDDcd001671.53E-65093No hitNo description
PfamPF002498.1E-75092IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MELPVSSDCG VYPSTNDNLL KDCTSGVTMA PASHDVAPQQ PAKQTRQWAA WTRQEEERFF  60
TALRQVGKNF EKITHRVQSK NKDQVRHYYY RLVRRMNKLL DPKIYLDASN SKDTNSAMLR  120
WWSLLEKSSC KASKLHLKPR RFKMFLDALE HQLLKDRRKN IRKRHAQGEV CPTTATATVL  180
SQGVNRTNCK GDMVPLKAVR QRRKPASYKR WEKAAIAGVS LVADAAEHLE RTALDEMTEQ  240
VRGGKCAEPV GNVVSSSATL LQNLFVDNSA QTPSKLKLQL FPIDESTRKA LEMDDYNPHL  300
ELTLSTRKRI SSVLEHLNRK WGMSSIACGE LLLLPYCAQK ENLVNCQRWT QDSILSAADV  360
YKQIGSPSIF RLRYCWLSNE QHELLACQAP VSNFSEQIAK MNGPQKMNIV PDFTPEHVPG  420
DPLDLRGDKV VSAEKFDDMV TSNLDVDDDI VECIDTNVDK DIVFSSENAP DISLQRESCN  480
LAITKQAQEK NEMQLQTGNL LTPGDWADSL TNISIGDLLN EASDNMETNY VGPSHASCQY  540
QVSFSCDSFD AAIAALMGKN QDKASFQPTL ESHAPSIWDA EETCDAFSFN RSSVSREKVL  600
GASTNDSSEA CRQQAKESLL ATDIVDKELS EMKELDNEAH GDPMDEFQPD PSTMESSAKE  660
DFTGLSDLCW SESLAPLDLD RPCKYHNEDL ILNDSMSGLN RLIASSLDAF QNCSFFGLDK  720
KESASTSAGE ARKSATFSDY KIGSEVEISK V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010653608.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X2
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLD7TQP70.0D7TQP7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1